Search results

Filter

Filetype

Your search for "*" yielded 548550 hits

Tuberculosis mortality during a civil war in Guinea-Bissau

CONTEXT: Tuberculosis (TB) is an increasing global problem, despite effective drug therapies. Access to TB therapy during conflict situations has not been studied. OBJECTIVE: To determine the effect of irregular TB treatment due to an armed conflict in Guinea-Bissau, West Africa. DESIGN, SETTING, AND PATIENTS: Ongoing retrospective cohort study conducted in the capital city of Bissau among 101 pat

Stationary NOx storage and reduction experiments on a heavy-duty diesel engine rig using a bypass system

This work concerns exhaust gas cleaning for heavy-duty diesel engines by means of NOx storage and redn. technol. A full-scale engine rig has been constructed, and stationary NOx redn. tests performed. In the NOx storage and redn. approach, NOx is stored on a BaO surface as Ba(NO3)2 under long lean conditions and desorbed and reduced under short rich conditions. The rich conditions are created by i

Charge and energy transfer in binaphthalene molecule with two spiropyran units used for chiral molecular switches and logic gates

A new binaphthalene molecule with two spiropyran units used for chiral molecular switches and logic gates was synthesized and chaxacterized.(12) In this paper, charge and energy transfer in binaphthalene molecule with two spiropyran units are theoretically investigated with quantum chemistry method, as well as 2D and 3D real space analysis methods, since molecule construction with photoinduced ele

Structure Functions and general final state properties in the linked dipole chain model

We have in an earlier paper, [1], presented a generalization, the Linked Dipole Chain Model LDC, of the model developed by Ciafaloni-Catani-Fiorani-Marchesini, [2], to decribe the structure functions and the states in Deep Inelastic Scattering events. In this paper we would like to present an investigation of a set of general features of the LDC Model, viz the behaviour of the structure functions

End-to-side nerve repair - A study in the forelimb of the rat

Popular Abstract in Swedish De perifera nervstammarna i extremiteterna förmedlar signaler, dels till muskler, dels från känselkroppar som är belägna i bl a huden. Nervstammarna kan av olika orsaker utsättas för skador orsakade av vassa eller skärande föremål eller av olika typer av slitvåld. Nervskador ger ett mycket stort handikapp för den enskilde patienten som förlorar muskelfunktion och känselNerve injuries have a profound impact on individuals, suffering for the patients and induce cost for society. When dealing with severe nerve injuries that create a gap between nerve segments or when the injury is at the brachial plexus level, the clinical alternatives are limited. The brachial plexus model and its branches in the forelimb was evaluated as an experimental model for studies of nerve

Unified model of fractal conductance fluctuations for diffusive and ballistic semiconductor devices

We present an experimental comparison of magnetoconductance fluctuations measured in the ballistic, quasiballistic, and diffusive scattering regimes of semiconductor devices. In contradiction to expectations, we show that the spectral content of the magnetoconductance fluctuations exhibits an identical fractal behavior for these scattering regimes and that this behavior is remarkably insensitive t

Temperaturmätningar i tegelskorsten vid oljeeldning med låg effekt

Rapport avseende mätningar utförda i experimentanläggning vid Institutionen för Byggnadskonstruktionslära, Lunds Tekniska Högskola. Projektet är en direkt fortsättning av projektet "Temperatur- och fuktmätningar i skorsten vid omväxlande olje- och elvärme (BKL 1986:26)

Effect of active site-inactivated factor VIIa on ischaemia/reperfusion injury in a porcine flap model.

In free flap surgery, restored blood flow following a lengthy ischaemic period may lead to necrosis as a result of ischaemia/reperfusion (IR) injury. This injury comprises both proinflammatory and prothrombotic events, where the tissue factor/factor VIIa complex probably has a key role. Active site-inactivated factor VIIa (FFR-rFVIIa) exerts an antithrombotic effect by binding to tissue factor wit

Emotion and social motivation in university students´ real life moral dilemmas

Studied the relationship between motivation and approaches to moral decision-making, and the emotions experienced in moral dilemmas. 44 students were interviewed about a dilemma they had faced. Intimacy was related to a preference for making decisions after having consulted others and to being open to their values and norms, whereas achievement was related to consequence-oriented reasoning and con

Bactericidal and hemolytic properties of mixed LL-37/surfactant systems

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

Measurement of protein diffusion through poly(D,L-lactide-co-glycolide)

A novel method was developed for studying the diffusion of proteins through poly(D,L-lactide-co-glycolide) (PLG), using a diffusion cell. To develop improved formulations for the controlled release of encapsulated drugs it is important to understand the underlying release mechanisms. When using low-molecular-weight PLG as the release-controlling polymer, diffusion through the pores is often propos

Sintering of alumina-supported nickel particles under amination conditions: Support effects

The sintering of alumina-supported nickel particles has been studied after heat-treatment in ammonia + hydrogen at 523 K and 250 bar. The investigated samples were nickel supported on gamma-alumina, transalumina and alpha-alumina, and co-precipitated nickel oxide-alumina. The sintering process was mainly followed by hydrogen chemisorption. The samples were also characterised by specific surface ar

Lipoic acid increases glutathione production and enhances the effect of mercury in human cell lines.

Thiols are known to influence the metabolism of glutathione. In a previous study (Toxicology 156 (2001) 93) dithiothreitol (DTT) did not show any effect on intra- or extracellular glutathione concentrations in HeLa cell cultures but increased the effects of mercury ions on glutathione concentrations, whereas monothiols such as N-acetylcysteine (NAC) or glutathione did not. In the present study, we

SCADA data and the quantification of hazardous events for QMRA

The objective of this study was to assess the use of on-line monitoring to support the QMRA at water treatment plants studied in the EU MicroRisk project. SCADA data were obtained from diary records, grab three Catchment-to-Tap Systems (CTS) along with system descriptions, sample data and deviation reports. Particular attention was paid to estimating hazardous event frequency, duration and magnitu