Remodeling of airway structures is a well-documented feature of allergic airway inflammation. To investigate whether bronchial remodeling is associated with remodeling of adjacent pulmonary vessels, sensitized mice were subjected to repeated ovalbumin inhalations, and bronchi and pulmonary vessels were subjected to histologic analysis. Allergen challenges induced peribronchial as well as perivascu

Hepatitis B virus (HBV) replication is initiated by HBV RT binding to the highly conserved encapsidation signal, epsilon, at the 5' end of the RNA pregenome. Epsilon contains an apical stem-loop, whose residues are either totally conserved or show rare non-disruptive mutations. Here we present the structure of the apical stem-loop based on NOE, RDC and H-1 chemical shift NMR data. The H-1 chemical

Monte Carlo simulations and density functional calculations have been performed for charged macromolecules confined to planar slits. The force between the confining walls has been evaluated as a function of separation, while keeping the chemical potential of the macromolecules constant. Highly charged spherical particles and flexible polyelectrolyte chains in confinement give rise to depletion and

Chemiluminescent (CL) enzyme-based flow-through microchip biosensors (mu-biosensors) for detection of glucose and ethanol were developed for the purpose of monitoring real-time production and release of glucose and ethanol from microchip immobilised yeast cells. Part I of this study focuses on the development and optimisation of the mu-biosensors in a microfluidic sequential injection analysis (mu

Introduction Aggrecanase cleavage at the (392)Glu-(393)Ala bond in the interglobular domain (IGD) of aggrecan, releasing N-terminal (393)ARGS fragments, is an early key event in arthritis and joint injuries. Here, we use a quantitative immunoassay of aggrecan ARGS neoepitope fragments in human synovial fluid to determine if this cleavage-site specific method better identifies joint pathology than

Previous research suggests that body dissatisfied women are particularly susceptible to negative affect following exposure to thin media images, whereas body satisfied women may even respond positively to such images. It was thus hypothesised that negative self-referent information would be more accessible in body dissatisfied women than in women satisfied with their bodies after viewing thin idea

The human melanocortin 4 receptor (MC4r) was successfully expressed in Sf9 cells using the baculovirus infection system. N- and C-terminally His-tagged receptors generated B-max values of 14 and 23 pmol receptor/mg membrane protein, respectively. The highest expression level obtained with the C-terminally His-tagged MC4r corresponded to 0.25 mg active receptor/litre culture volume. Addition of a v

We propose and demonstrate a technique combining micro-photoluminescence imaging with scanning photolithography at Cryogenic temperatures for creating photoresist masks at designated locations relative to single selected self-assembled quantum dots. The technique is demonstrated by producing a photoresist mask on top of a single selected InP quantum dot imbedded in GaInP. A mesa containing the qua

Human actions towards land, freshwater and oceans have already caused biodiversity to decline. This study aims to investigate attitudes towards the conservation of biological biodiversity among different groups in a Swedish city, Kristianstad. An inquiry including statements measuring attitudes towards the conservation of habitats, animals and plants, to the biological diversity within selected lo

The five ribosomal P-proteins, denoted P0-(P1-P2)(2), constitute the stalk structure of the large subunit of eukaryotic ribosomes. In the yeast Saccharomyces cerevisiae, the group of P1 and P2 proteins is differentiated into subgroups that form two separate P1A-P2B and P1B-P2A heterodimers on the stalk. So far, structural studies on the P-proteins have not yielded any satisfactory information usin

Cytokines such as interleukin 3 (IL-3), kit ligand (KL), and flt3 ligand (FL) promote survival of hematopoietic stem cells and myeloid progenitor cells. In many cell types, members of the Bcl-2 gene family are major regulators of survival, but the mediating mechanisms are not fully understood. Using two myeloid progenitor cell lines, FDCP-mix and FDC-P1, as well as primary mouse bone marrow progen

Although multiple system atrophy (MSA) is a neurodegenerative disorder leading to progressive disability and decreased life expectancy, little is known about patients' own evaluation of their illness and factors associated with poor health-related quality of life (Hr-QoL). We, therefore, assessed Hr-QoL and its determinants in MSA. The following scales were applied to 115 patients in the European

In the manufacture of heat-exchangers, it is of great importance that the heat-exchanger plates be thoroughly cleaned before being sealed. At a Swedish heat-exchanger manufacturer, oil, grease and other impurities are removed in a washing plant consisting of three stages: a degreasing tank and two rinsing tanks. The possibility of improving the cleanliness of the heat-exchanger plates, without inc

The coefficient of repeatability (COR), expressed as 2-SD of differences, was calculated between two measurements of oxygen consumption (V O2), heart rate (HR) and rating of perceived exertion (RPE) during ergometer cycling by men. The two sets of measurements were performed 5 to 6 weeks apart. Nineteen healthy men performed an incremental maximal exercise test on an ergometer cycle. The load star

In nonequimolar solutions of a cationic and an anionic surfactant, vesicles bearing a net charge can be spontaneously formed and apparently exist as thermodynamically stable aggregates. These vesicles can associate strongly with polymers in solution by means of hydrophobic and/or electrostatic interactions. In the current work, we have investigated the rheological and microstructural properties of

The evolution of bulk flow structures and their influence on the spatial distribution of heat release zones and of partially oxidized fuel and particulate matter (soot) is examined experimentally in a swirl-supported, direct-injection diesel engine. Vector fields describing the bulk flow structures are measured with particle image velocimetry (PIV), while complementary scalar field measurements of

Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieve