The aim of this study was to perform a preliminary assessment of the expected effective dose rate from external exposure to an adult individual staying at that part of the radioactively contaminated territory of the Vetka district of the Gomel region of the Republic of Belarus, from where residents had been resettled after the Chernobyl accident. For this assessment, in summer 2016 and 2018 soil s

In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta potential, ellipsometry, and circul

Given the tremendous phenomenological success of the Standard Model (SM) framework, it becomes increasingly important to understand to what extent its specific structure dynamically emerges from unification principles. In this study, we present a novel anomaly-free supersymmetric (SUSY) Grand Unification model based upon gauge trinification [SU(3)]3 symmetry and a local SU (2) F× U (1) F family sy

Background: Pancreatic cancer is predicted to become the second most common cause of cancer-related death by 2030. The objective of this study was to estimate the economic burden of pancreatic cancer for the years 2018 and 2030 based on changing demographics and incidence rates in Sweden. Method: The incidence of pancreatic cancer in Sweden and additional relevant data were obtained from official

OBJECTIVE: To characterize the lipid profile in vaginal discharge of women with vulvovaginal candidiasis, cytolytic vaginosis, or no vaginal infection or dysbiosis.DESIGN: Cross-sectional study.SETTING: Genital Infections Ambulatory, Department of Tocogynecology, University of Campinas, Campinas, São Paulo-Brazil.SAMPLE: Twenty-four women were included in this study: eight with vulvovaginal candid

Redan på 1840-talet hittades en pärlkedja i en grav i Lilla Uppåkra, 1986 hittades ytterligare en vid RAÄ Upppåkra 23, ca 1 km sydöst om Uppåkra kyrka. Dessa två pärlkedjor är bra exempel på hur pärlmodet förändras under 300-talet evt, från mindre uppsättningar med stor variation vad gäller pärltyper till större men mer homogena uppsättningar dominerade av röda, vita och gröna pärlor. I artikeln p

Summary: Background: Diabetes mellitus (DM) is a risk factor for peripheral arterial disease (PAD). Indications for open surgery in infrainguinal intermittent claudication (IC) are limited, and reports are lacking regarding outcomes in DM patients. Study aims were to compare short and long-term effects on major adverse cardiovascular events (MACE), acute myocardial infarction (AMI), stroke, major

OBJECTIVE: To evaluate endocervical and vaginal environment changes in women using a levonorgestrel-releasing intrauterine system (LNG-IUS).METHODS: A quasi-experimental study included sixty women who had an LNG-IUS inserted in the Family Planning Clinic of UNICAMP between April and November of 2016. Women in reproductive age, non-pregnant, without the use of antibiotics and contraceptives seeking

Precipitation over the Tibetan Plateau (TP) has major societal impacts in South and East Asia, but its spatiotemporal variations are not well understood, mainly because of the sparsely distributed in situ observation sites. With the help of the Global Precipitation Measurement satellite product IMERG and the ERA5 dataset, distinct precipitation seasonality features over the TP were objectively cla

Reinforcement learning systems usually assume that a value function is defined over all states (or state-action pairs) that can immediately give the value of a particular state or action. These values are used by a selection mechanism to decide which action to take. In contrast, when humans and animals make decisions, they collect evidence for different alternatives over time and take action only

The era of all-sky space astrometry began with the Hipparcos mission in 1989 and provided the first very accurate catalogue of apparent magnitudes, positions, parallaxes and proper motions of 120 000 bright stars at the milliarcsec (or milliarcsec per year) accuracy level. Hipparcos has now been superseded by the results of the Gaia mission. The second Gaia data release contained astrometric data

In this contribution, a finite element implementation of the stress gradient theory is proposed. The implementation relies on a reformulation of the governing set of partial differential equations in terms of one primary tensor-valued field variable of third order, the so-called generalised displacement field. Whereas the volumetric part of the generalised displacement field is closely related to