The development of inhibitory antibodies to factor VIII is a serious complication of hemophilia. FEIBA (factor VIII inhibitor-bypassing activity), an activated prothrombin complex concentrate (aPCC), and NovoSeven, recombinant factor Vila (rFVIIa), are used as hemostatic bypassing agents in treating patients with inhibitors. The FENOC study was designed to test equivalence of the products in the t

In recent years, there has been an increasing demand from manufacturing industries for new tool materials such as more wear resistant zinc-alloys, with optimised characteristics regarding short-run sheet-metal parts production. Research on zinc-alloys wear resistance has been performed by a lot of research groups. However, it is very difficult to compare the wear resistance of these materials due

The human B1 bradykinin (BK) receptor (B1R) is more efficacious than the human B2 BK receptor (B2R) in both ligand-independent and agonist-dependent coupling to Gq/11-mediated phospholipase Cbeta activity. In fact, B1R is constitutively active, whereas B2R exhibits little if any constitutive activity. To evaluate the role of the C-terminal domain in receptor Gq/11 coupling, we constructed chimeric

Pyrene chromophores carrying different rigid rod spacer groups (ethynylene, ethynylene-phenylene-ethynylene, and ethynylene-bicyclo[2.2.2]octylene-ethynylene) and bound to TiO2 nanostructured materials via an isophthalic acid (Ipa) anchor group have been investigated using quantum chemical calculations in order to elucidate structural and electronic properties of dye-sensitized semiconductor struc

Multiconfigurational second-order perturbation theory, both in its single-state multiconfigurational second-order perturbation theory (CASPT2) and multistate (MS-CASPT2) formulations, is used to search for minima on the crossing seams between different potential energy hypersurfaces of electronic states in several molecular systems. The performance of the procedures is tested and discussed, focusi

Modification of graphite based screen printed electrodes (SPEs) by electrosynthesised polyaniline (PANI) has been applied to improve the electron exchange between cellobiose dehydrogenase (CDH, EC 1.1.99.18) from the ascomycete Myriococcum thermophilum and the surface of the SPE. The redox intermediate layer of the conducting polymer promotes the bioelectrocatalysis providing a higher current for

OBJECTIVE: In acute lung injury (ALI) mechanical ventilation damages lungs. We hypothesised that aspiration and replacement of dead space during expiration (ASPIDS) allows normocapnic ventilation at higher end-expiratory pressure (PEEP) and reduced tidal volume (V(T)), peak and plateau pressures (Paw(peak), Paw(plat)), thus avoiding lung damage. SETTING: University Hospital. PATIENTS: Seven consec

This paper presents existence theories for several families of small-amplitude solitary-wave solutions to the classical two-dimensional water-wave problem in the presence of surface tension and with an arbitrary distribution of vorticity. Moreover, the established local bifurcation diagram for irrotational solitary waves is shown to remain qualitatively unchanged for any choice of vorticity distri

Cancer cells have aberrant patterns of DNA methylation including hypermethylation of gene promoter CpG islands and global demethylation of the genome. Genes that cause familial cancer, as well as other genes, can be silenced by promoter hypermethylation in sporadic tumors, but the methylation of these genes in tumors from kindreds with inherited cancer syndromes has not been well characterized. He

To maintain resting potentials in darkness, rod and cone photoreceptors incur a significant energy cost. But in brighter light, rods become energetically 'cheaper' than cones, which might explain the evolution of the vertebrate duplex retina.

Numerical simulations coupled with laser Doppler velocimetry (LDV) experiments were carried out to investigate a slot jet issued into a cross flow, which is relevant in the film cooling of gas turbine combustors. The film-cooling fluid injection from slots or holes into a cross flow produces highly complicated flow,fields. In this paper, the time-averaged Navier-Stokes equations were solved on a c

Males of the European pine sawfly, Neodiprion sertifer Geoffr., were marked and released downwind from pheromone traps, baited with 100 mug of the sex pheromone (2S,3S,7S)-3,7-dimethyl-2-pentadecyl acetate. Males were released 5 m downwind from one trap, or downwind from five traps, 50 m or 200 m away. The average capture rates after 24 hr were 21.5%, 17.7% and 3.8%, respectively. The capture rate

Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieve

The aim of the study was to determine whether indoor lighting and colour would have any systematic impact on the mood of people working indoors. Earlier studies have mostly focused either on light, colour or windows in laboratory settings. The present study was carried out in real work environments at different seasons and in countries with different latitudes. A total of 988 persons completed all